PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015872232.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 589aa    MW: 64289.4 Da    PI: 4.8015
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015872232.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS447.59.1e-1372175811374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv+ Ll+cAeav++ +l+la+al++++  las+++ +m+++a+yf+eALa+r++r    +y    p++  +++ s+ l++   f+e++P+lkf+h
  XP_015872232.1 217 LVHSLLACAEAVQE-NLKLADALVKHIGLLASSQAGAMRKVATYFAEALARRIYR----IY----PQDCLDSSYSDLLQM--HFYETCPYLKFAH 300
                     689*********97.9***************************************....44....444443335555444..5************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaIlea+++++rvH++Df+++qG+QWpaL+qaLa R++gpp +R+Tg+g+p+++++++l+++g +La++Ae++gv+fef+ +vak+l+dle
  XP_015872232.1 301 FTANQAILEAFATADRVHVVDFGLKQGMQWPALMQALALRAGGPPAFRLTGIGPPQPDNTDALQQVGLKLAQLAETVGVEFEFRGFVAKSLADLE 395
                     *********************************************************************************************** PP

            GRAS 191 leeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres...e 280
                     + +L+++p   EalaVn+v++lhrll++++++e+    vL+ +k ++Pk+v+vveqea+hn++ Fl+rf+e+l+yys lfdsle++  +     +
  XP_015872232.1 396 PGMLDIRPadVEALAVNSVFELHRLLARPGAIEK----VLSSIKAMKPKIVTVVEQEASHNGPVFLDRFTESLHYYSNLFDSLESSSTTGLappS 486
                     ********999***********************....*********************************************887443335779 PP

            GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++  +++++lgr+i+nvvaceg er+erhetl +Wr+rl++aGF pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  XP_015872232.1 487 QDLIMSEVYLGRQICNVVACEGPERFERHETLTQWRARLGSAGFDPVHLGSNAFKQASMLLALFAgGDGYRVEENNGCLMLGWHTRPLIATSAWQ 581
                     999*******************************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.1E-3539105IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.6E-3739111No hitNo description
PROSITE profilePS5098565.167191560IPR005202Transcription factor GRAS
PfamPF035143.2E-134217581IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MKRDYQDGCG SGGGSSNSVP VGKTKLWDEE QQEPGGAMDE LLAVLGYKVR ASDMAEVAQK  60
LEQLEMVMGS AQEDGISHLS DTVHYNPSDL SGWVQTMLTE LNTQPIDDES LLAPSESSTL  120
TSFDFSNSHH QIENQSRMVY NDDSEYDLRA IPGVAAFAPP QPQIESENTR KRLKTSIGST  180
SSSSPTPTQQ HVSVSVSGTE STRPMVLVDS QEAGVRLVHS LLACAEAVQE NLKLADALVK  240
HIGLLASSQA GAMRKVATYF AEALARRIYR IYPQDCLDSS YSDLLQMHFY ETCPYLKFAH  300
FTANQAILEA FATADRVHVV DFGLKQGMQW PALMQALALR AGGPPAFRLT GIGPPQPDNT  360
DALQQVGLKL AQLAETVGVE FEFRGFVAKS LADLEPGMLD IRPADVEALA VNSVFELHRL  420
LARPGAIEKV LSSIKAMKPK IVTVVEQEAS HNGPVFLDRF TESLHYYSNL FDSLESSSTT  480
GLAPPSQDLI MSEVYLGRQI CNVVACEGPE RFERHETLTQ WRARLGSAGF DPVHLGSNAF  540
KQASMLLALF AGGDGYRVEE NNGCLMLGWH TRPLIATSAW QLSESTQSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-542175814375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015872232.10.0PREDICTED: DELLA protein GAI-like isoform X1
SwissprotQ84TQ70.0GAI_GOSHI; DELLA protein GAI
TrEMBLA0A0D3LWI10.0A0A0D3LWI1_PRUMU; DELLA
STRINGVIT_14s0006g00640.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein